Bacterial taxon 909946
Locus STM474_0754
Protein WP_010988982.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 128 aa, Gene n/a, UniProt E8XAW4
>WP_010988982.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MSPVRVIFAFVSAIYGLLSALLLKTAGTQTCLLHVIFLVVSAGKILCMHQSTVTSLLFGSPLCERGDDLGTEQWALAGNDLINFELAANQERSNPSNVTCLSLITVLKEWVNIIVLLHNLLTGERVTP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 796,902 | -0.23 | 0.95 | ○○○○○ 0.06 | 0.0570605903533613 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 796,902 | 0.67 | 0.71 | ○○○○○ 0.52 | 0.524158546673569 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 796,902 | 1.03 | 0.16 | ○○○○○ 0.71 | 0.711918289016861 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)