Bacterial taxon 909946
Locus STM474_0840
Protein WP_000871970.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 136 aa, Gene ybhQ, UniProt E8XBS7
>WP_000871970.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MKWQQRVRVATGLGCWQIMLHLLVVAMLVIGWMSGTLVRVGLGLCVLYGVTVLLMLALQRHHEQRWRDVADVLEELTTTWYFGTALIVLWLLSRVLQNNVLLALAGLAILAGPAVVSLLAKDKKLHHFASKHRIRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 878,654 | -0.33 | 0.63 | ○○○○○ 0.01 | 0.00590771005727109 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 878,682 | -0.01 | 0.99 | ○○○○○ 0.17 | 0.170337264981195 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 878,682 | 0.32 | 0.81 | ○○○○○ 0.34 | 0.34274114985473 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 878,654 | 0.61 | 0.7 | ○○○○○ 0.49 | 0.493646357643555 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 878,654 | 0.71 | 0.85 | ○○○○○ 0.55 | 0.546515876896334 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 878,682 | 1.28 | 0.57 | ○○○○○ 0.84 | 0.839443077631162 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)