Bacterial taxon 909946
Locus STM474_2390
Protein WP_001574701.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 215 aa, Gene yfaZ, UniProt E8XED6
>WP_001574701.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MFLEWFLSALIPQRLAVQFCRFGEFFFMCLLERVKMKKSILLGFAGMLFVSASAQAISISGQAGEDYTNIGVGFGTESTGLALSGNWMHNDDDGDAAGVGLGLNIPVGPLLATVGGKGIYTNPKDSDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGIDSYEEANAGARFTIMRPLSIEAGYRYLNLAGKDGNRDNAIADGPYVGVNASF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,400,098 | -1.96 | 9.2e-5 | ●○○○○ -0.84 | -0.839529226118645 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,400,098 | -0.12 | 0.94 | ○○○○○ 0.11 | 0.11378239141015 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,400,098 | 0.02 | 1 | ○○○○○ 0.19 | 0.18955843541929 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)