Bacterial taxon 909946
Locus STM474_3193
Protein WP_000244756.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 137 aa, Gene ygfX, UniProt E8X9L7
>WP_000244756.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQDWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,226,736 | 1.86 | 0.031 | ○○○○○ 1.15 | 1.1452060328745 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,226,736 | -1.21 | 0.25 | ●○○○○ -0.45 | -0.452357651622684 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,226,995 | 0.1 | 0.96 | ○○○○○ 0.23 | 0.227062398999871 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,226,995 | 0.19 | 0.75 | ○○○○○ 0.28 | 0.27579549859142 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,226,736 | 0.63 | 0.87 | ○○○○○ 0.5 | 0.504899034190889 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,226,995 | 1.36 | 0.53 | ○○○○○ 0.88 | 0.884691276829352 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)