Bacterial taxon 909946
Locus STM474_3384
Protein WP_000785626.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 132 aa, Gene yqjE, UniProt E8XBF8
>WP_000785626.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MADSRQAQGPGKSVLGIGQRIVTIIVEMVETRLRLAVVELEEEKANLFQLLLMVGLTMLFAAFGLMSLMVLVIWAIDPQYRLNAMIATTVVLLVLALIGGIWTLRKARQSTLLRHTRHELANDRQILEDDQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,418,018 | 0.09 | 0.92 | ○○○○○ 0.23 | 0.225788114400993 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,418,018 | 0.11 | 0.94 | ○○○○○ 0.23 | 0.232322849931344 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,418,018 | 0.84 | 0.79 | ○○○○○ 0.62 | 0.615782318130429 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)