Bacterial taxon 909946
Locus STM474_3831
Protein WP_000340935.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 117 aa, Gene yiaB, UniProt E8XFX3
>WP_000340935.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MDDHVARRKRIFGLGMLVVGAVVYLVGLWPGCHTLSEKGYFFAAIVMCGFPVLIRQEHTGNGRLLSRCKSLLLLGIGMVAVGVFNLALAGALKILCLVALGVSIYGTDLYASYSDDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,749 | -3.56 | 1.9e-10 | ●●○○○ -1.67 | -1.67360898300701 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,743 | -3.07 | 3.9e-8 | ●●○○○ -1.42 | -1.4171802196056 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,960 | -2.72 | 0.0024 | ●●○○○ -1.23 | -1.23419804755366 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,749 | -2.43 | 0.039 | ●●○○○ -1.08 | -1.08294807554898 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,749 | -2.15 | 0.012 | ●○○○○ -0.94 | -0.939979897929827 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,865,960 | -1.8 | 0.0053 | ●○○○○ -0.76 | -0.756219455388459 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,960 | -1.93 | 0.11 | ●○○○○ -0.82 | -0.824437249596732 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,865,743 | -0.83 | 0.48 | ●○○○○ -0.25 | -0.253379542297824 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,865,743 | -0.65 | 0.8 | ●○○○○ -0.16 | -0.161641885122338 | 23637626 |
Retrieved 9 of 9 entries in 1.4 ms
(Link to these results)