Bacterial taxon 909946
Locus STM474_4118
Protein WP_000752579.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 117 aa, Gene n/a, UniProt E8XIP6
>WP_000752579.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MADAFILLGIVMAMVSLGFILINKLFCFISAGCLLSLCASMASFQLWDASYWGRWGKVCPGLDVIISCDNYHFLYDLGWELYGIAFLFFTALMLTCAAIILINMIMALERYCAGWRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,170,895 | -3.32 | 0.00052 | ●●○○○ -1.55 | -1.54608295582709 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,170,895 | -1.46 | 0.0074 | ●○○○○ -0.58 | -0.579834537089045 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,170,895 | 0.01 | 1 | ○○○○○ 0.18 | 0.180224725960385 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,170,741 | 0.44 | 0.91 | ○○○○○ 0.4 | 0.403419323639174 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,170,741 | 0.55 | 0.9 | ○○○○○ 0.46 | 0.460667830824819 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)