Bacterial taxon 909946
Locus STM474_4131
Protein WP_001738611.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 152 aa, Gene yigG, UniProt E8XJE2
>WP_001738611.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MPPLVRGVAYCHANDVTQHMDVKLMLSVFIPSSERCVSRCRYLLSFALINIIFSILVGVLLYLSFVILAILFTILLHYLVINLNCQRFRDSGFEYIKFYVWGTLVIYIASFVIMVAEDFACDGFGMPLFLIWYFATFSLLLLAPPDSNSLNK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,181,462 | -3.1 | 1.1e-9 | ●●○○○ -1.44 | -1.43530970948408 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,181,462 | -2.89 | 0.011 | ●●○○○ -1.32 | -1.32125828324338 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,181,462 | -1.44 | 0.37 | ●○○○○ -0.57 | -0.569858006364555 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)