Bacterial taxon 909946
Locus STM474_4340
Protein WP_001576436.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 107 aa, Gene n/a, UniProt E8XLA0
>WP_001576436.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MLDTEFRVACLQGKKMPAIISLIYLMFSLLVFTKKITISNVLSAFLLFLSLYILHHKSLLIFIYCLIIIVATAILHRVKTSADKKAVFYFSMPCWLLVLSVIININE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,395,844 | -0.07 | 0.92 | ○○○○○ 0.14 | 0.14257623968913 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,395,844 | 0.28 | 1 | ○○○○○ 0.32 | 0.320696773743819 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,395,844 | 0.31 | 0.93 | ○○○○○ 0.34 | 0.337086687053642 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,395,623 | 0.99 | 0.62 | ○○○○○ 0.69 | 0.689820860752537 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,395,623 | 1.35 | 0.71 | ○○○○○ 0.88 | 0.876226215239648 | 23637626 |
Retrieved 5 of 5 entries in 1.6 ms
(Link to these results)