Bacterial taxon 909946
Locus STM474_4458
Protein WP_000719058.1
membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 93 aa, Gene yjcB, UniProt E8X9R3
>WP_000719058.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein
MAAITTGVVLLRWQLLSAVLMFLASTLNIRFRKSDYIGLAVISSGLGVVSACWFATGLLGITMMDLAAIWHNIEAVMVETMSQTPPEWPMVLT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,523,101 | -0.47 | 0.71 | ●○○○○ -0.07 | -0.065661956365753 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,523,101 | -0.26 | 0.94 | ○○○○○ 0.04 | 0.0396067528172126 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,523,101 | 1.15 | 0.12 | ○○○○○ 0.78 | 0.776501560470527 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)