Bacterial taxon 909946
Locus STM474_4019
Protein WP_001307474.1
membrane protein insertion efficiency factor YidD
Salmonella enterica Serovar Typhimurium ST4 74
Length 85 aa, Gene yidd, UniProt E8XHS8
>WP_001307474.1|Salmonella enterica Serovar Typhimurium ST4 74|membrane protein insertion efficiency factor YidD
MAPPLSPGSRVLIALIRVYQRLISPLLGPHCRFTPTCSSYGIEALRRFGVIKGSWLTVKRVLKCHPLHPGGDDPVPPGPFDTREH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,067,539 | 0.16 | 0.92 | ○○○○○ 0.26 | 0.258554396773364 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,067,539 | 0.41 | 0.61 | ○○○○○ 0.39 | 0.390488557386311 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,067,539 | 1.24 | 0.6 | ○○○○○ 0.82 | 0.819064913459449 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)