Bacterial taxon 909946
Locus STM474_4769
Protein WP_000119016.1
metal-dependent hydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 257 aa, Gene yjjV, UniProt E8XCK8
>WP_000119016.1|Salmonella enterica Serovar Typhimurium ST4 74|metal-dependent hydrolase
MSWRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAALGLHPIVIERHADDDSDKLQQALAQQQNVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFAGSLQQAERFVRLGYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEPAEVIADTLYRNTITLFRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,839,051 | -0.94 | 0.11 | ●○○○○ -0.31 | -0.309362020950048 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,839,051 | 0.13 | 1 | ○○○○○ 0.25 | 0.245150677100616 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,839,051 | 0.73 | 0.55 | ○○○○○ 0.56 | 0.555945865746829 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)