Bacterial taxon 909946
Locus STM474_4290
Protein WP_000007508.1
methylenetetrahydrofolate reductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 296 aa, Gene metF, UniProt E8XL62
>WP_000007508.1|Salmonella enterica Serovar Typhimurium ST4 74|methylenetetrahydrofolate reductase
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSVIKGIKERTGLEAAPHLTCIDATRDELRTIARDYWNNGIRHIVALRGDLPPGSGKPEMYAADLVGLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPSWMSLMFEGLDNDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,340,177 | -1.69 | 0.00094 | ●○○○○ -0.7 | -0.700228905027504 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,340,177 | 0.18 | 1 | ○○○○○ 0.27 | 0.270511338346295 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)