Bacterial taxon 909946
Locus STM474_2471
Protein WP_000127736.1
MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 392 aa, Gene yfcj, UniProt E8XF27
>WP_000127736.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter
MTAVSQKTTTPSANFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHELGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMLACGLAGAAWLLAALLPVSAPVKFALLIVGRLILGFGESQLLTGTLTWGLGLVGPTRSGKVMSWNGMAIYGALAAGAPLGLLNHSHFGFAALAGTTMVLPLLAWAFNGTVRKVPAYTGERPSLWSVVGLIWKPGLGLALQGVGFAVIGTFISLYFVSNGWTMAGFTLTAFGGAFVLMRILFGWMPDRFGGVKVAVVSLLVETAGLLLLWLAPTAWIALVGAALTGAGCSLIFPALGVEVVKRVPAQVRGTALGGYAAFQDISYGVTGPLAGMLATSYGYPSVFLAGAISAVVGILVTILSFRRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,483,254 | 1.48 | 0.016 | ○○○○○ 0.95 | 0.947804170444957 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,483,346 | 0.13 | 0.94 | ○○○○○ 0.24 | 0.243371586394039 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,483,254 | 0.54 | 0.9 | ○○○○○ 0.46 | 0.456179471576209 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,483,254 | 1.05 | 0.35 | ○○○○○ 0.72 | 0.721499096210411 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,483,346 | 1.38 | 0.057 | ○○○○○ 0.89 | 0.893706949643215 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,483,346 | 2.91 | 0.5 | ○○○○○ 1.69 | 1.69057240631686 | 23637626 |
Retrieved 6 of 6 entries in 1.3 ms
(Link to these results)