Bacterial taxon 909946
Locus STM474_3748
Protein WP_001576500.1
MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 419 aa, Gene yhhS, UniProt E8XF93
>WP_001576500.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter
MIEKKTCCKNAVILMPEPVAEPALNGLRLNLRIVSIVMFNFASYLTIGLPLAVLPGYVHDAMGFSAFWAGLIISLQYFATLLSRPHAGRYADVLGPKKIVVFGLCGCFLSGLGYLLADIASAWPMISLLLLGLGRVILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMGAPLGVLCYAWGGLQGLALTVMGVALLAVLLALPRPSVKANKGKPLPFRAVLGRVWLYGMALALASAGFGVIATFITLFYDAKGWDGAAFALTLFSVAFVGTRLLFPNGINRLGGLNVAMICFGVEIIGLLLVGTAAMPWMAKIGVLLTGMGFSLVFPALGVVAVKAVPPQNQGAALATYTVFMDMSLGVTGPLAGLVMTWAGVPVIYLAAAGLVAMALLLTWRLKKRPPSALPEAASSS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,770,258 | 1.8 | 0.0068 | ○○○○○ 1.11 | 1.10955699293284 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,769,642 | 1.92 | 0.013 | ○○○○○ 1.18 | 1.17609807829343 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,770,258 | 0 | 0.86 | ○○○○○ 0.18 | 0.17946811089488 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,770,176 | 0.21 | 0.98 | ○○○○○ 0.29 | 0.287196140366723 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,770,176 | 0.3 | 0.7 | ○○○○○ 0.33 | 0.333642689965079 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,770,258 | 0.45 | 0.93 | ○○○○○ 0.41 | 0.412815177413651 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,770,242 | 0.54 | 0.41 | ○○○○○ 0.46 | 0.458605890680848 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,770,102 | 0.56 | 0.94 | ○○○○○ 0.47 | 0.466127502308734 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,769,642 | 0.65 | 0.86 | ○○○○○ 0.51 | 0.514043208316925 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,770,242 | 0.73 | 0.84 | ○○○○○ 0.56 | 0.555347366434857 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,769,642 | 0.87 | 0.45 | ○○○○○ 0.63 | 0.627247371549382 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,770,102 | 1.39 | 0.086 | ○○○○○ 0.9 | 0.898612197094278 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,770,102 | 1.55 | 0.44 | ○○○○○ 0.98 | 0.983741540152281 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,770,242 | 1.62 | 0.46 | ○○○○○ 1.02 | 1.01692961046151 | 23637626 |
Retrieved 14 of 14 entries in 1.1 ms
(Link to these results)