Bacterial taxon 909946
Locus STM474_4630
Protein WP_000661783.1
MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 408 aa, Gene n/a, UniProt E8XBI6
>WP_000661783.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter
MKEMQATLPQTFYIKPGKFIWSYLGTFLFMLGGCIENSWLSAWLNTQGFDQAHIGQIFAGYGIVVAITSWLSGVCVDVFGPKKVMVTGFIVYLLASVAFLNFALPSHDFGAILVTYMLRGVGYPLVCYSFLVRLTIQLDNHQQGIGTSLFWVVYNLGFTIIGPVVAASLIPELGHINVMWAGMGVALLGVLFMLVLERNEFILKPRTTPVFKELSAGISIMYERPRIGLAVIVKTINGLGTYGFVVVLPLFLLDKHFTLEEWASIWGITFISNQVFNIIFGWMGDKIGFRRTIQIFGSILTGVATLIVYWVPMIWGHNYVAFMLAMCLWGAGLAGFVPMTPLVPMMAPDKKGAANSAVNFGSGLGNFVGPALVSVLAGFGTGVVMYTMAGLYLFSGILVQFLKVPGEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,698,930 | -4.21 | 2.3e-13 | ●●●○○ -2.01 | -2.00930774765967 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,698,935 | -3.79 | 4.7e-13 | ●●○○○ -1.79 | -1.7936624384869 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,698,935 | -3.59 | 0.0004 | ●●○○○ -1.69 | -1.68894581538191 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,699,504 | -3.39 | 1.7e-9 | ●●○○○ -1.59 | -1.58507650929389 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,698,930 | -2.54 | 0.0015 | ●●○○○ -1.14 | -1.1397964683977 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,699,504 | -2.45 | 0.0094 | ●●○○○ -1.1 | -1.0969099344321 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,699,504 | -2.16 | 0.059 | ●○○○○ -0.95 | -0.946188926017371 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,698,935 | -1.52 | 0.28 | ●○○○○ -0.61 | -0.612941960418457 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,698,930 | -1.33 | 0.39 | ●○○○○ -0.51 | -0.51212814480476 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,699,533 | -0.91 | 0.099 | ●○○○○ -0.3 | -0.295625911811961 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,699,723 | -0.39 | 0.6 | ●○○○○ -0.02 | -0.0229150443177881 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,699,198 | -0.34 | 0.8 | ●○○○○ -0 | -0.0013194241572705 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,699,198 | 0.38 | 0.94 | ○○○○○ 0.38 | 0.375788022126138 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,699,533 | 0.41 | 0.97 | ○○○○○ 0.39 | 0.39074812490607 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,699,723 | 0.46 | 0.92 | ○○○○○ 0.42 | 0.415946890825667 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,699,723 | 1.14 | 0.45 | ○○○○○ 0.77 | 0.770722682844816 | 23637626 |
Retrieved 16 of 16 entries in 0.7 ms
(Link to these results)