Bacterial taxon 909946
Locus STM474_4717
Protein WP_000233260.1
MFS transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 394 aa, Gene yjiJ, UniProt E8XCF9
>WP_000233260.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter
MVHAQSASPRHPIFTALFGMMVLTLGMGVGRFLYTPMLPVMLAEKQLTFNQLSWIASANYAGYLAGSLLFSFGLFHLPSRLRPMLLASAVATGILILAMAIFTQPAVVMLVRFLAGVASAGMMIFGSMIVLHHTRHPFVIAALFSGVGAGIALGNEYVIGGLHYALSAHSLWLGAGALAGILLLIVAILIPPRAHALPPAPLARIENQPMPWWQLALLYGFAGFGYIIVATYLPLMAKSAGSPLLTAHLWSLVGLAIIPGCFGWLWAAKHWGVLPCLTANLLIQSACVLLSLASDSLLLLILSSIGFGATFMGTTSLVMPLARQLSAPGNINLLGLVTLTYGIGQILGPLAASLSGNGASAIINATLCGAAALFFAALISAVQQIKQKRFVIRE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,790,984 | -1.6 | 0.0022 | ●○○○○ -0.65 | -0.652733534432894 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,790,392 | 0.14 | 0.94 | ○○○○○ 0.25 | 0.247543294529287 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,790,859 | 0.16 | 0.82 | ○○○○○ 0.26 | 0.257611680603249 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,790,392 | 0.49 | 0.92 | ○○○○○ 0.43 | 0.433297348380025 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,790,392 | 0.5 | 0.53 | ○○○○○ 0.44 | 0.437869367672471 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,790,764 | 0.68 | 0.86 | ○○○○○ 0.53 | 0.530550543878632 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,790,859 | 0.76 | 0.57 | ○○○○○ 0.57 | 0.572023642865487 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,790,984 | 0.93 | 0.85 | ○○○○○ 0.66 | 0.657954557025886 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,790,984 | 1.07 | 0.49 | ○○○○○ 0.73 | 0.733847600564727 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,790,764 | 1.24 | 0.33 | ○○○○○ 0.82 | 0.822154679224762 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,790,764 | 1.38 | 0.066 | ○○○○○ 0.89 | 0.892285038409567 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,790,859 | 1.48 | 0.75 | ○○○○○ 0.94 | 0.944795123324892 | 23637626 |
Retrieved 12 of 12 entries in 1.1 ms
(Link to these results)