Bacterial taxon 909946
Locus STM474_3640
Protein WP_000185211.1
MFS transporter TsgA
Salmonella enterica Serovar Typhimurium ST4 74
Length 393 aa, Gene tsga, UniProt E8XEH6
>WP_000185211.1|Salmonella enterica Serovar Typhimurium ST4 74|MFS transporter TsgA
MTNSNRIKLTWISFLSYALTGALVIVTGMVMGNIADYFHLPVSSMSNTFTFLNAGILISIFLNAWLMEIIPLKTQLRFGFILMVLAVAGLMFGHSLALFSAAMFVLGLVSGITMSIGTFLITQLYEGRQRGSRLLFTDSFFSMAGMIFPMVAAFLLARSIEWYWVYACIGLVYLAIFILTFGCEFPALGKHAQHSQAPVVKEKWGIGVLFLAVAALCYILGQLGFISWVPEYAKGLGMSLNDAGALVSDFWMSYMFGMWAFSFILRFFDLQRILTVLAGMAAVLMYLFITGTQAHMPWFILTLGFFSSAIYTSIITLGSQQTKVASPKLVNFILTCGTIGTMLTFVVTGPIVAHSGPQAALLTANGLYAVVFVMCFALGFVSRHRQHSAPATH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,643,776 | 1.75 | 0.028 | ○○○○○ 1.08 | 1.08492687092182 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,644,668 | 2.1 | 0.0061 | ○○○○○ 1.27 | 1.26901972162386 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,643,852 | -0.32 | 0.83 | ○○○○○ 0.01 | 0.00892223179313908 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,644,405 | -0.27 | 0.85 | ○○○○○ 0.04 | 0.0366562397367704 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,644,668 | -0.02 | 0.99 | ○○○○○ 0.17 | 0.165673985473949 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,644,127 | 0.16 | 0.85 | ○○○○○ 0.26 | 0.257691681555551 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,643,852 | 0.19 | 0.98 | ○○○○○ 0.27 | 0.274104393301003 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,644,405 | 0.35 | 0.95 | ○○○○○ 0.36 | 0.358029313611791 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,643,852 | 0.7 | 0.22 | ○○○○○ 0.54 | 0.540191904207445 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,643,776 | 0.75 | 0.83 | ○○○○○ 0.57 | 0.565347837568051 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,644,555 | 0.84 | 0.79 | ○○○○○ 0.61 | 0.612029463803858 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,644,127 | 0.89 | 0.78 | ○○○○○ 0.64 | 0.639585385746306 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,644,127 | 1.02 | 0.58 | ○○○○○ 0.71 | 0.706360409406476 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,644,405 | 1.11 | 0.14 | ○○○○○ 0.76 | 0.755019250108608 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,644,555 | 1.4 | 0.62 | ○○○○○ 0.91 | 0.906363435151603 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,644,668 | 1.64 | 0.44 | ○○○○○ 1.03 | 1.02720212876656 | 23637626 |
Retrieved 16 of 16 entries in 1.5 ms
(Link to these results)