Bacterial taxon 909946
Locus STM474_3811
Protein WP_001082123.1
molecular chaperone LpfB
Salmonella enterica Serovar Typhimurium ST4 74
Length 232 aa, Gene lpfB, UniProt E8XFV4
>WP_001082123.1|Salmonella enterica Serovar Typhimurium ST4 74|molecular chaperone LpfB
MNRSRLISCTALVLALIAQNSFAGGVALSSTRVIYDGSRKEASLTVNNKSTTDEFLIQSWIDDANGNKKTPFIITPPLFKLSPTKNNVLRIVNTTNTLPQDRESVYWINVKAIPAKSEDAEAKNVLQIAVRTRLKLFYRPAGLKGNSMDGWNKLQFTSAGANQIKVENPSAFNLTFNKFYANGRDIEKTGMVPAKGSLNIELPAGTGKVSEVKYNIINDFGTAGDMLTQRVN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,847,983 | -0.48 | 0.52 | ●○○○○ -0.07 | -0.0731107091767139 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,847,983 | 0.15 | 1 | ○○○○○ 0.25 | 0.253674510576084 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)