Bacterial taxon 909946
Locus STM474_3998
Protein WP_000595421.1
molecular chaperone TorD
Salmonella enterica Serovar Typhimurium ST4 74
Length 210 aa, Gene torD, UniProt E8XHQ7
>WP_000595421.1|Salmonella enterica Serovar Typhimurium ST4 74|molecular chaperone TorD
MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKRQPALAASVALLEQKIAALSLRQDAQLELAADFCGLFLMTDKKSALPYASQYPQQEPGMIKHLLLEAGMEVNDDFKEPTDHLAIYLELLSHLHFSLGESFQQRRMNKLRQKTLSSLLEWLPEFTNNCLKHDPYGFYAALSQLLLAIVRFDDGKEDLSIVAAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,041,764 | 1.59 | 0.041 | ○○○○○ 1 | 1.00077881717357 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,041,764 | -2.15 | 0.067 | ●○○○○ -0.94 | -0.939679478517428 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,041,764 | -0.73 | 0.56 | ●○○○○ -0.2 | -0.201112662333984 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,041,750 | 0.22 | 0.77 | ○○○○○ 0.29 | 0.290815854342705 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,041,750 | 0.58 | 0.96 | ○○○○○ 0.48 | 0.476302597171857 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,041,750 | 0.87 | 0.63 | ○○○○○ 0.63 | 0.630915259755589 | 23637626 |
Retrieved 6 of 6 entries in 0.6 ms
(Link to these results)