Bacterial taxon 909946
Locus STM474_4173
Protein WP_001046887.1
molybdenum cofactor guanylyltransferase MobA
Salmonella enterica Serovar Typhimurium ST4 74
Length 194 aa, Gene mobA, UniProt E8XJH7
>WP_001046887.1|Salmonella enterica Serovar Typhimurium ST4 74|molybdenum cofactor guanylyltransferase MobA
MNLDEVITGVVLAGGKARRMGGADKGLLELGGKPLWRHVADALAPQLATVVISANRHLDIYQASGLKVIPDSIADFPGPLAGMLSVFQQVAGDWFLFCPCDNPCIPHNLVDRLAAQRHGAPVVWVHDGERDHPTIALINRAVEPQLTAYLQAGERRVMIFMRQVGGHAVDFSDCKEAFVNVNTPEELAQWQKRP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,223,866 | -5.61 | 4.9e-7 | ●●●○○ -2.74 | -2.73634017463832 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,223,866 | -0.85 | 0.7 | ●○○○○ -0.27 | -0.265983067571505 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,223,866 | -0.24 | 0.78 | ○○○○○ 0.05 | 0.0523480808490601 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,224,136 | 0 | 1 | ○○○○○ 0.18 | 0.177108712471058 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,224,136 | 0.17 | 1 | ○○○○○ 0.26 | 0.264350132912908 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,224,136 | 0.72 | 0.38 | ○○○○○ 0.55 | 0.548610602417361 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)