Bacterial taxon 909946
Locus STM474_0008
Protein WP_000380372.1
molybdopterin adenylyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 196 aa, Gene mogA, UniProt E8XG28
>WP_000380372.1|Salmonella enterica Serovar Typhimurium ST4 74|molybdopterin adenylyltransferase
MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRRLIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMRQISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVPYCIQLLDGPYVETAPEVVAAFRPKSARRENMSD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 9,222 | -2.48 | 0.029 | ●●○○○ -1.11 | -1.10849564854955 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 9,222 | 0.92 | 0.23 | ○○○○○ 0.65 | 0.654723777060163 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 9,222 | 2.75 | 0.17 | ○○○○○ 1.61 | 1.606434256939 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)