Bacterial taxon 909946
Locus STM474_4172
Protein WP_010989085.1
molybdopterin-guanine dinucleotide biosynthesis protein B
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene mobB, UniProt E8XJH6
>WP_010989085.1|Salmonella enterica Serovar Typhimurium ST4 74|molybdopterin-guanine dinucleotide biosynthesis protein B
MIPLLAIAAWSGTGKTTLLKKLIPALCAHGIRPGLIKHTHHDMDVDKPGKDSYELRKAGAAQTLVASQQRWALMTETPGQEELDLAWLVSRMDASKLDMVLVEGFKHEAVAKILLFRQGCGHSEEELILDEHVIAVASDIPLAVAVPVLDLNDVSQISAFILRWLEKARSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,223,433 | -1 | 0.082 | ●○○○○ -0.34 | -0.343031012005633 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,223,546 | -0.79 | 0.5 | ●○○○○ -0.24 | -0.235085829005354 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,223,433 | -0.64 | 0.61 | ●○○○○ -0.16 | -0.156630381205237 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,223,433 | 1.07 | 0.72 | ○○○○○ 0.73 | 0.733137507789314 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,223,546 | 1.33 | 0.55 | ○○○○○ 0.87 | 0.866505781454627 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,223,546 | 1.44 | 0.34 | ○○○○○ 0.93 | 0.926112458365462 | 23637626 |
Retrieved 6 of 6 entries in 1.4 ms
(Link to these results)