Bacterial taxon 909946
Locus STM474_0870
Protein WP_000829280.1
molybdopterin-synthase adenylyltransferase MoeB
Salmonella enterica Serovar Typhimurium ST4 74
Length 249 aa, Gene moeB, UniProt E8XBV7
>WP_000829280.1|Salmonella enterica Serovar Typhimurium ST4 74|molybdopterin-synthase adenylyltransferase MoeB
MAELSDQEMLRYNRQIILRGFDFEGQEALKDARVLVVGLGGLGCAATQYLAGAGVGQLTLLDFDTVSVSNLQRQTLHSDATVGQPKVESARDALARINPHITITPVNARLDDDAMTSLIAGHSLVLDCTDNVSVRNQLNAGCYTAKVPLISGAAIRMEGQVTVFTYRENEPCYRCLSRLFGENALTCVEAGVMAPLIGVIGSLQAMEAIKLLAHYGQPASGKIVMYDAMTCQFREMKLMRNPGCEVCGQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 914,547 | -2.11 | 0.086 | ●○○○○ -0.92 | -0.919703686663047 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 914,547 | 0.38 | 0.61 | ○○○○○ 0.37 | 0.37266208505178 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 914,547 | 3.25 | 0.098 | ○○○○○ 1.87 | 1.8671448195616 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)