Bacterial taxon 909946
Locus STM474_3486
Protein WP_000044652.1
monofunctional biosynthetic peptidoglycan transglycosylase
Salmonella enterica Serovar Typhimurium ST4 74
Length 242 aa, Gene mtgA, UniProt E8XD29
>WP_000044652.1|Salmonella enterica Serovar Typhimurium ST4 74|monofunctional biosynthetic peptidoglycan transglycosylase
MSKRRIAPLTFLRRLLLRILAALAVFWGGGIALFSVVPVPFSAVMAERQISAWLGGEFGYVAHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLSQQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQRYFHKPASRLSLSEAALLAAVLPNPIRYKANAPSGYVRSRQAWIMRQMRQLGGESFMTRNQLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,510,767 | 1.52 | 0.038 | ○○○○○ 0.96 | 0.964509781925626 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,510,767 | -0.02 | 0.99 | ○○○○○ 0.17 | 0.165789541308721 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,510,767 | 1.27 | 0.28 | ○○○○○ 0.84 | 0.836059059315779 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)