Bacterial taxon 909946
Locus STM474_3628
Protein WP_000047690.1
monooxygenase
Salmonella enterica Serovar Typhimurium ST4 74
Length 103 aa, Gene ydhR, UniProt E8XE06
>WP_000047690.1|Salmonella enterica Serovar Typhimurium ST4 74|monooxygenase
MSKTLLQIHFNFSGPFGEEMTQQLVGLAESINEEPGFIWKIWTESEKNQQAGGIYLFESEETAQAYIKKHTARLKNLGVDEVTFTLFGVNDALTKINHGNLCR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,633,855 | -0.49 | 0.54 | ●○○○○ -0.08 | -0.0759342840822977 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,633,855 | 1.46 | 0.52 | ○○○○○ 0.94 | 0.936885167108956 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,633,855 | 1.72 | 0.28 | ○○○○○ 1.07 | 1.06846124152547 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)