Bacterial taxon 909946
Locus STM474_1955
Protein WP_000795653.1
motility protein MotB
Salmonella enterica Serovar Typhimurium ST4 74
Length 309 aa, Gene motB, UniProt E8XA70
>WP_000795653.1|Salmonella enterica Serovar Typhimurium ST4 74|motility protein MotB
MKNQAHPIVVVKRRRHKPHGGGAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAEYFRTPLATAVTGGNRIANSESPIPGGGDDYTQQQGEVEKQPNIDELKKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGPDDAINRRISLLVLNKQAEQAILHENAESQNEPVSVLQQPAAAPPASVPTSPKAEPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,977,259 | -3.52 | 0.17 | ●●○○○ -1.65 | -1.65131126492123 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,977,358 | -1.51 | 0.26 | ●○○○○ -0.61 | -0.605023701398739 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,977,259 | -0.76 | 0.75 | ●○○○○ -0.22 | -0.21575435404296 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,977,358 | -0.16 | 0.96 | ○○○○○ 0.1 | 0.0959880283049053 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,977,358 | -0.16 | 0.79 | ○○○○○ 0.1 | 0.0962736986598724 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,977,259 | -0.02 | 0.98 | ○○○○○ 0.17 | 0.167808494657231 | 23637626 |
Retrieved 6 of 6 entries in 0.9 ms
(Link to these results)