Bacterial taxon 909946
Locus STM474_3973
Protein WP_000828740.1
multidrug efflux MFS transporter EmrD
Salmonella enterica Serovar Typhimurium ST4 74
Length 394 aa, Gene emrD, UniProt E8XHN3
>WP_000828740.1|Salmonella enterica Serovar Typhimurium ST4 74|multidrug efflux MFS transporter EmrD
MKRQRNVNLLLMLVLLVAVGQMAQTIYIPAIADMAQALNVREGAVQSVMAAYLLTYGVSQLFYGPLSDRVGRRPVILVGMSIFMVATLFAMTTHSLTVLIAASAMQGMGTGVGGVMARTLPRDLYEGTQLRHANSLLNMGILVSPLLAPLIGSLLDTLWNWRACYAFLLVLCAGVTFSMARWMPETRPAGAPRTRLIASYKTLFGNGAFNCYLLMLIGGLAGIAVFEACSGVLMGAVLGLSSMVVSILFILPIPAAFFGAWFAGRPNKRFSTLMWQSVICCLLAGLMMWIPGWFGVMNVWTLLIPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQNIGSGVLAWLSAMLPQTGQGSLGLLMTLMGLLILACWLPLASRISHQGQTV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,021,951 | -2.34 | 0.027 | ●●○○○ -1.04 | -1.03853097153378 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,021,715 | -1.04 | 0.35 | ●○○○○ -0.36 | -0.362073371479192 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,021,349 | -1.03 | 0.59 | ●○○○○ -0.36 | -0.357414239738634 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,021,349 | -0.3 | 0.72 | ○○○○○ 0.02 | 0.0230104690298501 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,021,468 | -0.26 | 0.72 | ○○○○○ 0.04 | 0.0436305315572076 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,021,951 | -0.22 | 0.95 | ○○○○○ 0.06 | 0.0635177309165187 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,021,951 | -0.1 | 0.91 | ○○○○○ 0.13 | 0.127010186988903 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,021,468 | 0.16 | 1 | ○○○○○ 0.26 | 0.261553434621468 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,021,715 | 0.78 | 0.93 | ○○○○○ 0.58 | 0.58296945011157 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,021,715 | 1 | 0.2 | ○○○○○ 0.69 | 0.69457018551614 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,021,468 | 1.05 | 0.53 | ○○○○○ 0.72 | 0.722528183247213 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,021,349 | 1.08 | 0.67 | ○○○○○ 0.74 | 0.739099738825438 | 23637626 |
Retrieved 12 of 12 entries in 1.3 ms
(Link to these results)