Bacterial taxon 909946
Locus STM474_4719
Protein WP_001188918.1
multidrug efflux MFS transporter MdtM
Salmonella enterica Serovar Typhimurium ST4 74
Length 413 aa, Gene yjiO, UniProt E8XCG1
>WP_001188918.1|Salmonella enterica Serovar Typhimurium ST4 74|multidrug efflux MFS transporter MdtM
MQRIIQFFSQRATTLFFPMALILYDFAAYLTTDLIQPGIINVVRDFNADVSLAPASVSLYLAGGMALQWLLGPLSDRIGRRPVLIAGALIFTLACAATLLTTSMTQFLVARFVQGTSICFIATVGYVTVQEAFGQTKAIKLMAIITSIVLVAPVIGPLSGAALMHFVHWKVLFGIIAVMGLLALCGLLLAMPETVQRGAVPFSAVSVLRDFRNVFRNPIFLTGAATLSLSYIPMMSWVAVSPVILIDAGGMSTSQFAWAQVPVFGAVIVANMIVVRLVKDPTRPRFIWRAVPIQLSGLATLLLGNLLLPHVWLWSVLGTSLYAFGIGMIFPTLFRFTLFSNNLPKGTVSASLNMVILTVMAVSVEVGRWLWFHGGRLPFHLLAAVAGVIVVFTLATLLQRVRQHEAAELAAEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,793,281 | -1.56 | 0.12 | ●○○○○ -0.63 | -0.633163977039435 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,793,114 | -0.33 | 0.59 | ○○○○○ 0 | 0.00366272185994326 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,793,281 | -0.08 | 0.98 | ○○○○○ 0.14 | 0.135931948486309 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,793,114 | 0.91 | 0.63 | ○○○○○ 0.65 | 0.652266608292181 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,793,281 | 0.98 | 0.18 | ○○○○○ 0.69 | 0.685337556513435 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,793,114 | 2.6 | 0.16 | ○○○○○ 1.53 | 1.52931733037235 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)