Bacterial taxon 909946
Locus STM474_1665
Protein WP_000159242.1
multidrug transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 112 aa, Gene n/a, UniProt E8XJY3
>WP_000159242.1|Salmonella enterica Serovar Typhimurium ST4 74|multidrug transporter
MTKEAVIFLFIAIVVEVIATISLKLSDSFTRLVPSLVTIIGYCIAFWCLTIPMRTIPAGIIYAIWSGVGIVLIGLIGWLFLGQKLDVPAIIGMLLIICGVIVINLFSKSVSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,703,805 | -4.48 | 0.0024 | ●●●○○ -2.15 | -2.14890815476316 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,703,805 | -1.34 | 0.0081 | ●○○○○ -0.52 | -0.521163431616374 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,703,805 | -2.06 | 0.097 | ●○○○○ -0.89 | -0.89063702002985 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)