Bacterial taxon 909946
Locus STM474_3168
Protein WP_000597495.1
multidrug/biocide efflux PACE transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 160 aa, Gene n/a, UniProt E8X9J3
>WP_000597495.1|Salmonella enterica Serovar Typhimurium ST4 74|multidrug/biocide efflux PACE transporter
MIKSKVFSFMQHDAIQRRSLPERIFHAVCFEGIATAILAPTTAWLMQRSVLEMGGLTILLATTAMIWNIIYNALFDRLWPAHQVRRTAKVRALHALGFESGFIVIGVSIVAWVLNVSLLQAFTLEIGFFLFFLPYTMLYNWAYDVLRQRIVTRRQQRVSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,203,596 | 0.26 | 0.97 | ○○○○○ 0.31 | 0.310171206357407 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,203,596 | 0.77 | 0.63 | ○○○○○ 0.58 | 0.575247802087813 | 23637626 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)