Bacterial taxon 909946
Locus STM474_0527
Protein WP_001010574.1
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Salmonella enterica Serovar Typhimurium ST4 74
Length 204 aa, Gene tesA, UniProt E8X893
>WP_001010574.1|Salmonella enterica Serovar Typhimurium ST4 74|multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 565,527 | 0.9 | 0.77 | ○○○○○ 0.65 | 0.646362337452911 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 565,527 | 1.16 | 0.59 | ○○○○○ 0.78 | 0.780710999416932 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 565,527 | 1.52 | 0.057 | ○○○○○ 0.97 | 0.967186064635121 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)