Bacterial taxon 909946
Locus STM474_1529
Protein WP_000783049.1
multiple antibiotic resistance protein MarB
Salmonella enterica Serovar Typhimurium ST4 74
Length 71 aa, Gene marB, UniProt E8XI98
>WP_000783049.1|Salmonella enterica Serovar Typhimurium ST4 74|multiple antibiotic resistance protein MarB
MKMLFPALPGLLLIASGYGIAEQTLLPVAQNSRDVMLLPCVGDPPNDLHPVSVNSDKSDELGVPYYNDQHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,553,797 | 1.26 | 0.66 | ○○○○○ 0.83 | 0.829288333673381 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,553,797 | 2.22 | 0.44 | ○○○○○ 1.33 | 1.3291979957861 | 23637626 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)