Bacterial taxon 909946
Locus STM474_0327
Protein WP_001225658.1
murein L,D-transpeptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 246 aa, Gene yafK, UniProt E8XJL5
>WP_001225658.1|Salmonella enterica Serovar Typhimurium ST4 74|murein L,D-transpeptidase
MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVYIQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLKPDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALVFGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYVVSKPLSHEVVQPQLASNYTLSEAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 356,598 | -4.4 | 9.7e-16 | ●●●○○ -2.11 | -2.10831251381977 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 356,744 | -1.75 | 0.0097 | ●○○○○ -0.73 | -0.729587744874622 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 356,744 | 1.31 | 0.045 | ○○○○○ 0.86 | 0.857613812004217 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 356,598 | -1.96 | 0.062 | ●○○○○ -0.84 | -0.843302234530278 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 356,435 | -1.51 | 0.13 | ●○○○○ -0.61 | -0.606664014593416 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 356,598 | -0.76 | 0.76 | ●○○○○ -0.22 | -0.219436783580709 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 356,744 | -0.44 | 0.89 | ●○○○○ -0.05 | -0.0525270438603062 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 356,435 | 0.92 | 0.76 | ○○○○○ 0.65 | 0.653777281836814 | 23637626 |
Retrieved 8 of 8 entries in 1.1 ms
(Link to these results)