Bacterial taxon 909946
Locus STM474_1693
Protein WP_000219126.1
murein tripeptide amidase MpaA
Salmonella enterica Serovar Typhimurium ST4 74
Length 242 aa, Gene ycjI, UniProt E8XK09
>WP_000219126.1|Salmonella enterica Serovar Typhimurium ST4 74|murein tripeptide amidase MpaA
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAVNRESGLILAGTHGDETSSVVTLSCALRTLNPTLRRHHVVLAVNPDGCQLGLRANANGIDLNRNFPAANWKAGETVYRWNSRAQERDVVLLTGDHPGSEPETQALCQLIHRLQPAWVVSFHDPLACIEDPRRSELGEWLADAFALPLVTSVGYETPGSFGSWCADLNLHCITAEFPPVSADEASEKYLLAMSNLLRWHPKDGVDPS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,730,835 | -0.26 | 0.69 | ○○○○○ 0.04 | 0.0432768387633252 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,730,835 | 0.76 | 0.55 | ○○○○○ 0.57 | 0.56925390687512 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,730,835 | 0.91 | 0.91 | ○○○○○ 0.65 | 0.651282314227446 | 23637626 |
Retrieved 3 of 3 entries in 2 ms
(Link to these results)