Bacterial taxon 909946
Locus STM474_3430
Protein WP_000908562.1
N-acetyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 167 aa, Gene yhbS, UniProt E8XC89
>WP_000908562.1|Salmonella enterica Serovar Typhimurium ST4 74|N-acetyltransferase
MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVVGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHYDLHCRWPGTESAFQVHRLAEDALEGVTGLVEYHDHFNRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,460,167 | -0.68 | 0.39 | ●○○○○ -0.18 | -0.176777685575046 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,460,167 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.542955754804063 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,460,167 | 1.73 | 0.47 | ○○○○○ 1.08 | 1.07713397966924 | 23637626 |
Retrieved 3 of 3 entries in 2 ms
(Link to these results)