Bacterial taxon 909946
Locus STM474_3712
Protein WP_001290288.1
N-acetyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 162 aa, Gene yhhY, UniProt E8XEP8
>WP_001290288.1|Salmonella enterica Serovar Typhimurium ST4 74|N-acetyltransferase
MSEIVIRHAEPKDYDTIRQIHAQPEVYHNMLQVPHPSLEMWQARLTEQAGVKQLVACIDDIVVGHLSIQVTQRPRRSHVADFGICVDARWHNRGIASALIRTMIDMCDNWLRVDRIELTVFVDNEPAVAVYKKYGFEIEGTGKKYGLRNGEYVDAYFMARVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,737,384 | -0.53 | 0.68 | ●○○○○ -0.1 | -0.0974188389224476 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,737,384 | 0.57 | 0.89 | ○○○○○ 0.47 | 0.474186907954116 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,737,384 | 1.13 | 0.13 | ○○○○○ 0.76 | 0.764770471986261 | 23637626 |
Retrieved 3 of 3 entries in 2.2 ms
(Link to these results)