Bacterial taxon 909946
Locus STM474_4029
Protein WP_001527038.1
NAD(P)H-dependent oxidoreductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 194 aa, Gene yieF, UniProt E8XHT8
>WP_001527038.1|Salmonella enterica Serovar Typhimurium ST4 74|NAD(P)H-dependent oxidoreductase
MKKGARMSETLNVVTLLGSLRKGSFNGMVARTLPKVAPAGMTVSPLPSIGDIPLYDADIQQEEGFPASVEALAEQIRNADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQTSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVVDQGTLDHLTGQLTAFGEFIQRVKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,774 | 2.61 | 0.0072 | ○○○○○ 1.53 | 1.53094658320206 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,661 | -0.12 | 0.88 | ○○○○○ 0.12 | 0.115906879896548 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,774 | 0.06 | 1 | ○○○○○ 0.21 | 0.209015014856258 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,078,661 | 0.12 | 0.95 | ○○○○○ 0.24 | 0.23838640030844 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,963 | 0.58 | 0.89 | ○○○○○ 0.48 | 0.477700734696828 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,963 | 0.71 | 0.35 | ○○○○○ 0.54 | 0.543489333543956 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,588 | 0.81 | 0.81 | ○○○○○ 0.6 | 0.598386475585221 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,661 | 0.91 | 0.77 | ○○○○○ 0.65 | 0.647256380850668 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,588 | 1.17 | 0.14 | ○○○○○ 0.78 | 0.783498798731289 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,078,774 | 2.17 | 0.33 | ○○○○○ 1.3 | 1.30316879265526 | 23637626 |
Retrieved 10 of 10 entries in 0.9 ms
(Link to these results)