Bacterial taxon 909946
Locus STM474_4029
Protein WP_001527038.1
NAD(P)H-dependent oxidoreductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 194 aa, Gene yieF, UniProt E8XHT8
>WP_001527038.1|Salmonella enterica Serovar Typhimurium ST4 74|NAD(P)H-dependent oxidoreductase
MKKGARMSETLNVVTLLGSLRKGSFNGMVARTLPKVAPAGMTVSPLPSIGDIPLYDADIQQEEGFPASVEALAEQIRNADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQTSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVVDQGTLDHLTGQLTAFGEFIQRVKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,774 | 2,61 | 0,0072 | ○○○○○ 1,53 | 1.53094658320206 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,661 | -0,12 | 0,88 | ○○○○○ 0,12 | 0.115906879896548 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,774 | 0,06 | 1 | ○○○○○ 0,21 | 0.209015014856258 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,078,661 | 0,12 | 0,95 | ○○○○○ 0,24 | 0.23838640030844 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,963 | 0,58 | 0,89 | ○○○○○ 0,48 | 0.477700734696828 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,963 | 0,71 | 0,35 | ○○○○○ 0,54 | 0.543489333543956 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,588 | 0,81 | 0,81 | ○○○○○ 0,6 | 0.598386475585221 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,078,661 | 0,91 | 0,77 | ○○○○○ 0,65 | 0.647256380850668 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,078,588 | 1,17 | 0,14 | ○○○○○ 0,78 | 0.783498798731289 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,078,774 | 2,17 | 0,33 | ○○○○○ 1,3 | 1.30316879265526 | 23637626 |
Retrieved 10 of 10 entries in 1 ms
(Link to these results)