Bacterial taxon 909946
Locus STM474_1112
Protein WP_001062899.1
NAD(P)H:quinone oxidoreductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 198 aa, Gene wraB, UniProt E8XE76
>WP_001062899.1|Salmonella enterica Serovar Typhimurium ST4 74|NAD(P)H:quinone oxidoreductase
MAKILVLYYSMYGHIETMAHAVAEGAKKVDGAEVIIKRVPETMPPEIFAKAGGKTQNAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGSLYGKLGSVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,161,880 | -1.52 | 0.29 | ●○○○○ -0.61 | -0.613131970924297 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,161,880 | -0.69 | 0.57 | ●○○○○ -0.18 | -0.18026610224839 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,161,880 | -0.34 | 0.67 | ●○○○○ -0 | -0.000528396182369658 | 23637626 |
Retrieved 3 of 3 entries in 1.9 ms
(Link to these results)