Bacterial taxon 909946
Locus STM474_2424
Protein WP_000386728.1
NADH-quinone oxidoreductase subunit B
Salmonella enterica Serovar Typhimurium ST4 74
Length 220 aa, Gene nuoB, UniProt E8XEH0
>WP_000386728.1|Salmonella enterica Serovar Typhimurium ST4 74|NADH-quinone oxidoreductase subunit B
MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQPERERKRGERIAVTNLRTPDEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,436,289 | -7.7 | 1.9e-8 | ●●●●○ -3.82 | -3.82392225727817 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,436,289 | -5.14 | 2.2e-14 | ●●●○○ -2.49 | -2.49153004263735 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,436,289 | -2.69 | 6.1e-7 | ●●○○○ -1.22 | -1.22023539879284 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)