Bacterial taxon 909946
Locus STM474_2425
Protein WP_000062993.1
NADH-quinone oxidoreductase subunit NuoA
Salmonella enterica Serovar Typhimurium ST4 74
Length 147 aa, Gene nuoA, UniProt E8XEH1
>WP_000062993.1|Salmonella enterica Serovar Typhimurium ST4 74|NADH-quinone oxidoreductase subunit NuoA
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARIGALDWTPARSRRERMNPETNSIANRQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,437,144 | -6.09 | 2.0e-23 | ●●●○○ -2.99 | -2.98687597891374 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,437,144 | -5.07 | 5.7e-15 | ●●●○○ -2.46 | -2.45713716217212 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,437,129 | -3.92 | 3.1e-13 | ●●○○○ -1.86 | -1.85876935574777 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,437,144 | -2.68 | 0.02 | ●●○○○ -1.22 | -1.21656945749753 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,437,129 | -2.3 | 0.048 | ●●○○○ -1.02 | -1.01709248354471 | 23637626 |
Retrieved 5 of 5 entries in 0.5 ms
(Link to these results)