Bacterial taxon 909946
Locus STM474_2418
Protein WP_000172747.1
NADH-quinone oxidoreductase subunit NuoI
Salmonella enterica Serovar Typhimurium ST4 74
Length 180 aa, Gene nuoI, UniProt E8XEG4
>WP_000172747.1|Salmonella enterica Serovar Typhimurium ST4 74|NADH-quinone oxidoreductase subunit NuoI
MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,428,488 | -5.3 | 1.5e-16 | ●●●○○ -2.58 | -2.57602450786776 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,428,488 | -2.6 | 0.025 | ●●○○○ -1.17 | -1.17411271826318 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,428,488 | -2.59 | 0.028 | ●●○○○ -1.17 | -1.16855075683907 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,428,082 | -1.23 | 0.25 | ●○○○○ -0.46 | -0.460948054494474 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,428,082 | -0.66 | 0.39 | ●○○○○ -0.17 | -0.167996401306626 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,428,082 | -0.49 | 0.87 | ●○○○○ -0.08 | -0.0778167090709696 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)