Bacterial taxon 909946
Locus STM474_3155
Protein WP_000558962.1
NADP(H)-dependent aldo-keto reductase
Salmonella enterica Serovar Typhimurium ST4 74
Length 346 aa, Gene tas, UniProt E8X9I0
>WP_000558962.1|Salmonella enterica Serovar Typhimurium ST4 74|NADP(H)-dependent aldo-keto reductase
MHYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAIANGINLIDAAEMYPVPPRPETQGLTESYIGNWLAKRGNREKLIIASKVSGPARNNDQGIRPHQALDRKNIREALHDSLTRLQTDYLDLYQVHWPQRPTNCFGKLGYNWTDSTPVVSLLETLDALSEFQRAGKIRYIGVSNETAFGVMRYLHLAEKHDLPRIVTIQNPYSLLNRSYEVGLAEVSQYEGVELLAYSCLAFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQAQKAVASYVDIAKRHNLDPAQMALAFVRRQPFVASTLLGATTMAQLKTNVESLHLTLSEEVLAEIEAAHQVYTYPAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,187,014 | -1.34 | 0.019 | ●○○○○ -0.52 | -0.518250932892927 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,187,104 | 1.93 | 0.0081 | ○○○○○ 1.18 | 1.18081356139383 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,187,236 | 1.96 | 0.015 | ○○○○○ 1.2 | 1.19719867883219 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,187,582 | -0.88 | 0.44 | ●○○○○ -0.28 | -0.280700058357287 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,187,236 | -0.3 | 0.82 | ○○○○○ 0.02 | 0.0196591270354309 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,187,104 | -0.29 | 0.93 | ○○○○○ 0.03 | 0.0258307971797894 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,187,236 | 0.07 | 1 | ○○○○○ 0.22 | 0.215967619055258 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,187,582 | 0.2 | 0.98 | ○○○○○ 0.28 | 0.282370890232759 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,187,104 | 0.3 | 0.82 | ○○○○○ 0.33 | 0.332495556460095 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,187,582 | 0.35 | 0.67 | ○○○○○ 0.36 | 0.360738093997985 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,187,014 | 0.5 | 0.91 | ○○○○○ 0.44 | 0.43500999069061 | 23637626 |
Retrieved 11 of 11 entries in 1.1 ms
(Link to these results)