Bacterial taxon 909946
Locus STM474_2235
Protein WP_000837534.1
Ni(II)/Co(II) efflux transporter accessory subunit RcnB
Salmonella enterica Serovar Typhimurium ST4 74
Length 104 aa, Gene n/a, UniProt E8XCY8
>WP_000837534.1|Salmonella enterica Serovar Typhimurium ST4 74|Ni(II)/Co(II) efflux transporter accessory subunit RcnB
MKSKLLPCALLLATSFAWAAPATTGIDQYELKSFIADFTHFKPGDTVPQMYRTDEYNIKQWKLRNLPAPDAGTHWTYMGGAYVLINDTDGKIIKAYDGEIFYHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,240,258 | -1.12 | 0.07 | ●○○○○ -0.41 | -0.40506060264673 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,240,258 | 0.18 | 0.9 | ○○○○○ 0.27 | 0.268822323816951 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,240,258 | 0.7 | 0.85 | ○○○○○ 0.54 | 0.540652968436074 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)