Bacterial taxon 909946
Locus STM474_3170
Protein WP_000019953.1
Ni(II)/Co(II)-binding transcriptional repressor RcnR
Salmonella enterica Serovar Typhimurium ST4 74
Length 90 aa, Gene yohL, UniProt E8X9J5
>WP_000019953.1|Salmonella enterica Serovar Typhimurium ST4 74|Ni(II)/Co(II)-binding transcriptional repressor RcnR
MSHTIRDKQKLKARTSKIQGQVIALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTEHIVHQSDEARREEDLDVILKVLDSYIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,205,319 | 0.79 | 0.82 | ○○○○○ 0.59 | 0.587358770330154 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,205,319 | 1.35 | 0.64 | ○○○○○ 0.88 | 0.876465358111375 | 23637626 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)