Bacterial taxon 909946
Locus STM474_3298
Protein WP_000017678.1
Ni/Fe-hydrogenase cytochrome b subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 392 aa, Gene hybB, UniProt E8XAJ8
>WP_000017678.1|Salmonella enterica Serovar Typhimurium ST4 74|Ni/Fe-hydrogenase cytochrome b subunit
MSHDPKPLGGKIISKPVIIFGPLIVLCMLLIVKRLVFGLGSVSDLNGGFPWGVWIAFDLLIGTGFACGGWALAWAVYVFNRGQYHPLVRPALLASLFGYSLGGLSITIDVGRYWNLPYFYIPGHFNVNSVLFETAVCMTIYIGVMALEFAPALFERLGWKVSLKRLNKVMFFIIALGALLPTMHQSSMGSLMISAGYKVHPLWQSYEMLPLFSVLTAFIMGFSIVIFEGSLVQAGLKGNGPDEKNLFVKLTNTISVLLAIFVVLRFGELIYRDKLSYAFAGDFYSAMFWIEVVLMVFPLVVLRVAKLRNDSRMLYLSALSALLGCATWRLTYSLVAFNPGGGYHYFPTWEELLISIGFVAIEICAYIVLIRLLPILPPLKQNDHNRHEASKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,331,607 | -6.28 | 1.4e-7 | ●●●●○ -3.08 | -3.08259610490099 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,331,465 | -5.2 | 3.3e-6 | ●●●○○ -2.53 | -2.52590428905171 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,331,434 | -1.79 | 0.39 | ●○○○○ -0.75 | -0.754310848109427 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,331,663 | -1.7 | 0.39 | ●○○○○ -0.71 | -0.705452245209599 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,331,663 | -0.66 | 0.61 | ●○○○○ -0.17 | -0.165082829678963 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,331,434 | -0.51 | 0.37 | ●○○○○ -0.09 | -0.0879475899979412 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,331,465 | -0.36 | 0.81 | ●○○○○ -0.01 | -0.0105125862797012 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,331,607 | -0.04 | 0.96 | ○○○○○ 0.16 | 0.15571811464706 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,331,434 | 0.14 | 0.93 | ○○○○○ 0.25 | 0.249658416655352 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,331,607 | 0.69 | 0.6 | ○○○○○ 0.54 | 0.536742008742265 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,331,663 | 1.21 | 0.12 | ○○○○○ 0.81 | 0.807671174415436 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,331,465 | 1.45 | 0.082 | ○○○○○ 0.93 | 0.932359211551702 | 23637626 |
Retrieved 12 of 12 entries in 1 ms
(Link to these results)