Bacterial taxon 909946
Locus STM474_0782
Protein WP_000345368.1
nicotinamide riboside transporter PnuC
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene pnuC, UniProt E8XAY7
>WP_000345368.1|Salmonella enterica Serovar Typhimurium ST4 74|nicotinamide riboside transporter PnuC
MDFFSTHNILIHIPIGAGGYDLSWIEAVGTIAGLLCIWLASLEKISNYFFGLVNVTLFAIIFFQIQLYASLLLQLFFFAANIYGWYAWSRQTKDNQAELKIRWLPLPKAMAWLAICVIAIGLMTRYIDPVFAVLTRVAVAIMQMLGLQVTMPVLQPDAFPFWDSCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYLILTFIAVNGSRLWINSARERGSRALSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 820,958 | -2.8 | 0.0049 | ●●○○○ -1.28 | -1.27531362431987 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 820,958 | -0.25 | 0.94 | ○○○○○ 0.05 | 0.0495989112796448 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 820,958 | 0.25 | 0.75 | ○○○○○ 0.31 | 0.308634225886881 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)