Bacterial taxon 909946
Locus STM474_3643
Protein WP_000493569.1
nitrite transporter NirC
Salmonella enterica Serovar Typhimurium ST4 74
Length 269 aa, Gene nirC, UniProt E8XEH9
>WP_000493569.1|Salmonella enterica Serovar Typhimurium ST4 74|nitrite transporter NirC
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLVMGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTISHGQMWAILPQTWLGNLVGSVFVALLYSWGGGSLLPVDTSIVHSVALAKTTAPATVLFFKGALCNWLVCLAIWMAIRTEGTAKFLAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSDAYTLAGIGHNLLWVTLGNTLSGVVFMGLGYWYATPKSERPAPAKINQPEAAANN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,648,829 | -5.07 | 1.2e-17 | ●●●○○ -2.46 | -2.45764301833419 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,648,829 | -0.95 | 0.41 | ●○○○○ -0.32 | -0.31520695436982 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,648,829 | -0.5 | 0.91 | ●○○○○ -0.08 | -0.082088119920459 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,648,495 | 0.35 | 0.95 | ○○○○○ 0.36 | 0.357923780551161 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,648,495 | 0.4 | 0.76 | ○○○○○ 0.39 | 0.387420422117815 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,648,495 | 1.24 | 0.56 | ○○○○○ 0.82 | 0.81846294616376 | 23637626 |
Retrieved 6 of 6 entries in 1.2 ms
(Link to these results)