Bacterial taxon 909946
Locus STM474_4790
Protein WP_000554311.1
non-canonical purine NTP phosphatase
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene yjjX, UniProt E8XDB8
>WP_000554311.1|Salmonella enterica Serovar Typhimurium ST4 74|non-canonical purine NTP phosphatase
MHQVISATTNPAKIQAILQAFEEIFGEGSCHITPVAVESGVPEQPFGSEETRAGARNRVDNARRLHPQADFWVAIEAGIDDDATFSWVVIDNGVQRGEARSATLPLPAVILDRVRQGEALGPVMSQYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVILALSPFHNAVYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,862,171 | 0.39 | 0.62 | ○○○○○ 0.38 | 0.380052322518448 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,862,171 | 0.81 | 0.81 | ○○○○○ 0.6 | 0.600340617937058 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,862,171 | 2.21 | 0.33 | ○○○○○ 1.32 | 1.32269102489807 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)