Bacterial taxon 909946
Locus STM474_1967
Protein WP_000920611.1
non-heme ferritin
Salmonella enterica Serovar Typhimurium ST4 74
Length 165 aa, Gene ftn, UniProt E8XA81
>WP_000920611.1|Salmonella enterica Serovar Typhimurium ST4 74|non-heme ferritin
MLKTEMIDKLNEQMNLELYSSLLYQQMSAWCSYHSFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGSLPRIHTVSSPFAEYASLDELFRATYEHEQLITQKINELAHAAMTSQDYPTFNFLQWYVAEQHEEEKLFKSIIDKLTLAGKSGEGLYFIDKELSTLDTQN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,987,198 | -1.26 | 0.022 | ●○○○○ -0.48 | -0.475731914840487 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,987,198 | -0.96 | 0.4 | ●○○○○ -0.32 | -0.322873920111251 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,987,198 | 0.98 | 0.74 | ○○○○○ 0.69 | 0.686793525964523 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)